SEQanswers

SEQanswers (http://seqanswers.com/forums/index.php)
-   Bioinformatics (http://seqanswers.com/forums/forumdisplay.php?f=18)
-   -   tblastn bug? (http://seqanswers.com/forums/showthread.php?t=58648)

Antony03 05-18-2015 08:57 AM

tblastn bug?
 
Hello,

I have a problem with tblastn. I tried to research this protein sequence:

>BN1129_RS00085
MNKVLVAGILGLMLTACGQKEEAAAPAATPAADVAATVEQAASEATSTVEKVASEATATVEKAVSKAEAAVSDAKAN

In the draft sequence with the accession number: CDBI00000000.1

The problem is that the result is truncated, which is a non-sense since the protein sequence come from this accession number! I tried locally with tfasty36 and there is no problem.

Is someone has an idea?

Thank you!

maubp 05-29-2015 05:28 AM

By default BLAST uses low complexity filters to remove/mask some of the sequence. Try turning off these filters?


All times are GMT -8. The time now is 11:20 PM.

Powered by vBulletin® Version 3.8.9
Copyright ©2000 - 2020, vBulletin Solutions, Inc.