Unconfigured Ad

Collapse
X
 
  • Filter
  • Time
  • Show
Clear All
new posts
  • savisco
    Junior Member
    • Oct 2019
    • 1

    Genes from GBK

    I have a list of genes and i want to obtain all the information in CDS and GENE from a genome in .gbk format.
    I am trying to find some script or software that will allow me to get the part of the gbk file referring to the names of several genes.

    For example of this file. And i want to obtain just the part of the product with name "korC".
    Code:
    Input:
    [I]LOCUS       MH558576               11275 bp    DNA     linear   BCT 03-SEP-2018
    DEFINITION  Klebsiella pneumoniae strain KP21-KPC plasmid, partial sequence.
    ACCESSION   MH558576
    VERSION     MH558576.1
    KEYWORDS    .
    SOURCE      Klebsiella pneumoniae
      ORGANISM  Klebsiella pneumoniae
                Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
                Enterobacteriaceae; Klebsiella.
    REFERENCE   1  (bases 1 to 11275)
      AUTHORS   Wang,P., Hu,Y., Yi,G., Shen,X., Wang,Z., Ma,R., Shan,B. and Wang,Y.
      TITLE     Clone dissemination of blaKPC-2 and blaNDM-1 co-producing clinical
                isolates of Klebsiella pneumoniae in a Chinese teaching hospital
      JOURNAL   Unpublished
    REFERENCE   2  (bases 1 to 11275)
      AUTHORS   Wang,P., Hu,Y., Yi,G., Shen,X., Wang,Z., Ma,R., Shan,B. and Wang,Y.
      TITLE     Direct Submission
      JOURNAL   Submitted (02-JUL-2018) Department of Key Laboratory, The 2nd
                Affiliated Hospital of Kunming Medical University, 374 Dian Mian
                Road, Kunming, Yunnan 650101, China
    COMMENT     ##Assembly-Data-START##
                Sequencing Technology :: Sanger dideoxy sequencing
                ##Assembly-Data-END##
    FEATURES             Location/Qualifiers
         source          1..11275
                         /organism="Klebsiella pneumoniae"
                         /mol_type="genomic DNA"
                         /strain="KP21-KPC"
                         /isolation_source="urine"
                         /db_xref="taxon:573"
                         /plasmid="unnamed"
                         /country="China: Kunming,YN"
                         /collection_date="2010"
         CDS             43..759
                         /codon_start=1
                         /transl_table=11
                         /product="IS6-like element IS26 family transposase"
                         /protein_id="AXS01185.1"
                         /translation="MELHSRVFEM"
         gene            862..1272
                         /gene="tnpR"
                         /note="truncated TnpR resolvase"
         CDS             1395..2375
                         /codon_start=1
                         /transl_table=11
                         /product="IS481-like element ISKpn27 family transposase"
                         /protein_id="AXS01186.1"
                   /translation="MTQALHSQARTTHLIREEIRNSTLPQAELARMYNVTRQTIRKWQ
                         EKRPELFRKRVYNQPGLDI"
         gene            2651..3532
                         /gene="kpc"
                         /note="carbapenem-hydrolyzing class A beta-lactamase
                         KPC-2"
         CDS             2651..3532
                         /gene="kpc"
                         /codon_start=1
                         /transl_table=11
                         /product="carbapenem-hydrolyzing class A beta-lactamase
                         KPC-2"
                         /protein_id="AXS01187.1"
                         /translation="MSLYRRLVLLSCLSYVNGQ"
         gene            complement(4767..5063)
                         /gene="korC"
                         /note="transcriptional repressor protein KorC"
         CDS             complement(4767..5063)
                         /gene="korC"
                         /codon_start=1
                         /transl_table=11
                         /product="transcriptional repressor protein KorC"
                         /protein_id="AXS01188.1"
                         /translation="MIRPETLRSKTNPSPIAYGAWSILAHLAGFGAIWDADRD"
         gene            complement(5392..5817)
                         /gene="klca"
                         /note="antirestriction protein"
         CDS             complement(5392..5817)
                         /gene="klca"
                         /codon_start=1
                         /transl_table=11
                         /product="antirestriction protein"
                         /protein_id="AXS01189.1"
                         /translation="MMQTELNPLICSLVRDWACEHDEKEAILAAID"
         CDS             complement(5928..6206)
                         /codon_start=1
                         /transl_table=11
                         /product="hypothetical protein"
                         /protein_id="AXS01190.1"
                         /translation="MIHTANRTFHQLYRSLELNKMWLSWREKK"
         CDS             7749..8309
                         /codon_start=1
                         /transl_table=11
                         /product="TnpR resolvase"
                         /protein_id="AXS01191.1"
                         /translation="MQGHRIGALAKQRGAYRGRKKALSDEQAATLRQRATA
                         GEPKAQLAREFNISRETLYQYLRTDD"
         CDS             8313..>11275
                         /codon_start=1
                         /transl_table=11
                         /product="Tn3-like element TnAs1 family transposase"
                         /protein_id="AXS01192.1"
                         /translation="MPRREHINLTGDYVWRQSR
                         RLEDGKFRPLRMPGKP"[/I]

    output:
    Code:
       [I]gene            complement(4767..5063)
                         /gene="korC"
                         /note="transcriptional repressor protein KorC"
         CDS             complement(4767..5063)
                         /gene="korC"
                         /codon_start=1
                         /transl_table=11
                         /product="transcriptional repressor protein KorC"
                         /protein_id="AXS01188.1"
                         /translation="MIRPETLRSKTNPSPIAYGAWSILAHLAGFGAIWDADRD"[/I]
    Last edited by GenoMax; 10-30-2019, 10:16 AM. Reason: Added [code] tags
  • maubp
    Peter (Biopython etc)
    • Jul 2009
    • 1544

    #2
    What do you want to do with the text snippet next?

    Can you program? If so, I would suggest looking at Biopython, BioPerl or a similar library which has a GenBank parser. They would let you parse the GenBank file, and select the feature with name korC, and do something with it - be that just print it out, or further processing.

    Comment

    Latest Articles

    Collapse

    • GATTACAT
      Reply to Nine Things a Sample Prep Scientist Thinks About Before Sequencing
      by GATTACAT
      Love this - good data definitely starts from good input, and poor input can only give relatively poor data. I particularly like the mention of Nanodrop/absorbance based methods for quantification. It's such a toss up if you'll get an accurate reading or what amounts to a randomly generated number, and a lot of library/sequencing related issues can be traced back to poor quant.
      07-01-2026, 11:43 AM
    • SEQadmin2
      Nine Things a Sample Prep Scientist Thinks About Before Sequencing
      by SEQadmin2


      I’m not a sequencing expert. I’m a purification scientist who uses NGS to evaluate workflows my group develops. With this perspective, we think about the sample first and the NGS workflow second. The sequencer is an exceptionally honest reporter, but it can only report on what you give it, so whether you get clean, interpretable data from an NGS workflow is largely determined before you begin.

      Here are nine questions we think about, in roughly the order they matter, before...
      06-18-2026, 07:11 AM

    ad_right_rmr

    Collapse

    News

    Collapse

    Topics Statistics Last Post
    Started by SEQadmin2, 07-02-2026, 11:08 AM
    0 responses
    19 views
    0 reactions
    Last Post SEQadmin2  
    Started by SEQadmin2, 06-30-2026, 05:37 AM
    0 responses
    20 views
    0 reactions
    Last Post SEQadmin2  
    Started by SEQadmin2, 06-26-2026, 11:10 AM
    0 responses
    21 views
    0 reactions
    Last Post SEQadmin2  
    Started by SEQadmin2, 06-17-2026, 06:09 AM
    0 responses
    54 views
    0 reactions
    Last Post SEQadmin2  
    Working...