Thread: tblastn bug?
View Single Post
Old 05-18-2015, 08:57 AM   #1
Antony03
Member
 
Location: Canada, Quebec

Join Date: Apr 2012
Posts: 53
Default tblastn bug?

Hello,

I have a problem with tblastn. I tried to research this protein sequence:

>BN1129_RS00085
MNKVLVAGILGLMLTACGQKEEAAAPAATPAADVAATVEQAASEATSTVEKVASEATATVEKAVSKAEAAVSDAKAN

In the draft sequence with the accession number: CDBI00000000.1

The problem is that the result is truncated, which is a non-sense since the protein sequence come from this accession number! I tried locally with tfasty36 and there is no problem.

Is someone has an idea?

Thank you!
Antony03 is offline   Reply With Quote