tblastn bug?

Antony03 · 05-18-2015, 09:57 AM

Hello,

I have a problem with tblastn. I tried to research this protein sequence:

>BN1129_RS00085
MNKVLVAGILGLMLTACGQKEEAAAPAATPAADVAATVEQAASEATSTVEKVASEATATVEKAVSKAEAAVSDAKAN

In the draft sequence with the accession number: CDBI00000000.1

The problem is that the result is truncated, which is a non-sense since the protein sequence come from this accession number! I tried locally with tfasty36 and there is no problem.

Is someone has an idea?

Thank you!

maubp · 05-29-2015, 06:28 AM

By default BLAST uses low complexity filters to remove/mask some of the sequence. Try turning off these filters?

Similar Threads
Thread	Thread Starter	Forum	Replies	Last Post
translated seq of tblastn hits	carolW	Bioinformatics	0	10-29-2014 08:16 AM
tblastn and blastx question	Nepa10	Bioinformatics	3	09-24-2014 01:07 AM
Is it a bug in BWA?	SD2010Bioinfo	Bioinformatics	4	10-11-2012 06:27 PM
is it bug in cufflinks?	jay2008	Bioinformatics	0	10-10-2012 03:16 PM
Inquiry of Parsing tblastn result to get nucleotide sequence from the db file	sunfuhui	Bioinformatics	2	09-12-2012 06:39 AM

05-18-2015, 09:57 AM	#1
Antony03 Member Location: Canada, Quebec Join Date: Apr 2012 Posts: 53	tblastn bug? Hello, I have a problem with tblastn. I tried to research this protein sequence: >BN1129_RS00085 MNKVLVAGILGLMLTACGQKEEAAAPAATPAADVAATVEQAASEATSTVEKVASEATATVEKAVSKAEAAVSDAKAN In the draft sequence with the accession number: CDBI00000000.1 The problem is that the result is truncated, which is a non-sense since the protein sequence come from this accession number! I tried locally with tfasty36 and there is no problem. Is someone has an idea? Thank you!

05-29-2015, 06:28 AM	#2
maubp Peter (Biopython etc) Location: Dundee, Scotland, UK Join Date: Jul 2009 Posts: 1,543	By default BLAST uses low complexity filters to remove/mask some of the sequence. Try turning off these filters?