SEQanswers

Go Back   SEQanswers > Bioinformatics > Bioinformatics



Similar Threads
Thread Thread Starter Forum Replies Last Post
BLAST+ creating custom blast database and using blast+ filtering features deniz Bioinformatics 3 07-07-2019 08:04 AM
install local blast shuang Bioinformatics 6 07-07-2019 07:53 AM
How to create a BLAST database aliealexandre Bioinformatics 22 02-02-2015 03:34 AM
Local BLAST installation on Linux lindashirley99 Bioinformatics 10 03-17-2014 02:08 AM
BLAST database error - when changing to new BLAST+ local program biobio Bioinformatics 4 06-15-2011 05:20 AM

Reply
 
Thread Tools
Old 03-05-2011, 09:16 PM   #1
SeqClark
Junior Member
 
Location: NJ

Join Date: Mar 2011
Posts: 2
Question Create local BLAST database

Hi there,

I tried to use makeblastdb to create a local BLAST database and got the following error message. I checked the FASTA format of my file and it seemed to be OK. No idea how to correct this problem. Any help would be greatly appreciated.

"Error: NCBI C++ Exception:
"..\..\..\..\..\src\serial\objistrasnb.cpp", line 164: Error: ncbi::CObjectI
StreamAsnBinary::UnexpectedTagClassByte() - byte 0: unexpected tag class/constru
cted: #255, should be #160 ( at Seq-entry)"
SeqClark is offline   Reply With Quote
Old 03-05-2011, 09:20 PM   #2
SeqClark
Junior Member
 
Location: NJ

Join Date: Mar 2011
Posts: 2
Default

FAST sequence sample

>gi|157676334|ref|NP_067082.2| transmembrane protein 8A precursor [Homo sapiens]
MGRAGTGTGGEAVAAVVAGPLLLLLLARPPPASAGYSGKSEVGLVSEHFSQAPQRLSFYSWYGSARLFRF
RVPPDAVLLRWLLQVSRESGAACTDAEITVHFRSGAPPVINPLGTSFPDDTAVQPSFQVGVPLSTTPRSN
ASVNVSHPAPGDWFVAAHLPPSSQKIELKGLAPTCAYVFQPELLVTRVVEISIMEPDVPLPQTLLSHPSY
LKVFVPDYTRELLLELRDCVSNGSLGCPVRLTVGPVTLPSNFQKVLTCTGAPWPCRLLLPSPPWDRWLQV
TAESLVGPLGTVAFSAVAALTACRPRSVTIQPLLQSSQNQSFNASSGLLSPSPDHQDLGRSGRVDRSPFC
LTNYPVTREDMDVVSVHFQPLDRVSVRVCSDTPSVMRLRLNTGMDSGGSLTISLRANKTEMRNETVVVAC
VNAASPFLGFNTSLNCTTAFFQGYPLSLSAWSRRANLIIPYPETDNWYLSLQLMCPENAEDCEQAVVHVE
TTLYLVPCLNDCGPYGQCLLLRRHSYLYASCSCKAGWRGWSCTDNSTAQTVAQQRAATLLLTLSNLMFLA
PIAVSVRRFFLVEASVYAYTMFFSTFYHACDQPGEAVLCILSYDTLQYCDFLGSGAAIWVTILCMARLKT
VLKYVLFLLGTLVIAMSLQLDRRGMWNMLGPCLFAFVIMASMWAYRCGHRRQCYPTSWQRWAFYLLPGVS
MASVGIAIYTSMMTSDNYYYTHSIWHILLAGSAALLLPPPDQPAEPWACSQKFPCHYQICKNDREELYAV
T
SeqClark is offline   Reply With Quote
Old 03-07-2011, 01:17 AM   #3
rglover
rg
 
Location: uk

Join Date: Dec 2008
Posts: 51
Default

What version of the NCBI executables are you using? What command line arguments are you using to create your database?
rglover is offline   Reply With Quote
Reply

Thread Tools

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off




All times are GMT -8. The time now is 12:16 PM.


Powered by vBulletin® Version 3.8.9
Copyright ©2000 - 2019, vBulletin Solutions, Inc.
Single Sign On provided by vBSSO