SEQanswers

Go Back   SEQanswers > Bioinformatics > Bioinformatics



Similar Threads
Thread Thread Starter Forum Replies Last Post
Extract sequence from multi fasta file with PERL andreitudor Bioinformatics 26 12-05-2017 09:51 PM
Make Clean and Make all not working qnc Bioinformatics 27 10-21-2011 10:17 AM
help needed to retrieve fasta reads from fasta db prashanthpnu Bioinformatics 1 06-21-2011 05:59 AM
Gene prediction programs that work with multi-fasta files Hobbe Bioinformatics 0 11-16-2010 01:31 AM
Cuffdiff multi-protein vs multi-promoter RockChalkJayhawk Bioinformatics 2 03-26-2010 10:26 AM

Reply
 
Thread Tools
Old 04-14-2012, 04:55 PM   #1
detq182
Member
 
Location: Colombia

Join Date: Feb 2012
Posts: 20
Post Make Multi-fasta with annotations

Hi everyone

Im ending my work and i have a problem, how can i make that my multi-fasta file with the query sequence has a descriptions using the annotations hits that i get from blast, here is and example:

>CL44Contig4 Nascent polypeptide associated complex alpha
ACACGACGACTTCGAGCGGCCGAACCCGGGCAGGTACGAACGGGGGGCAAGCTA

Anyone try to make this before???
detq182 is offline   Reply With Quote
Old 04-14-2012, 11:15 PM   #2
azneto
Member
 
Location: Brazil

Join Date: Dec 2009
Posts: 23
Default

http://www.bioperl.org/wiki/HOWTO:SearchIO
azneto is offline   Reply With Quote
Old 04-15-2012, 04:38 AM   #3
detq182
Member
 
Location: Colombia

Join Date: Feb 2012
Posts: 20
Default

hi
could you be more specific? im starting with perl.
detq182 is offline   Reply With Quote
Old 04-15-2012, 05:17 AM   #4
detq182
Member
 
Location: Colombia

Join Date: Feb 2012
Posts: 20
Default

please some help here.

i have a big problem i just cant make with bioperl this;
>CL56Contig1 Nascent polypeptide associated complex alpha
MVGGGNRRDEASFTVTNTNGFAALESLRKKKKSDKEKGSSKGGKGSSKAAGGGQNAEPEK
QVYLPGRQSSC..
its seem to be rigth but the sequence is a protein and my query is a DNA :
>CL56Contig1
ACACGACGACTTCGAGCGGCCGAACCCGGGCAGGTACGAACGGGGGGCAAGCTA..

how can i replace the protein secuence with the dna secuence? help me.
detq182 is offline   Reply With Quote
Old 04-15-2012, 05:50 AM   #5
azneto
Member
 
Location: Brazil

Join Date: Dec 2009
Posts: 23
Default

http://seqanswers.com/forums/showthread.php?t=10018
azneto is offline   Reply With Quote
Reply

Tags
blast, formatdb

Thread Tools

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off




All times are GMT -8. The time now is 11:03 AM.


Powered by vBulletin® Version 3.8.9
Copyright ©2000 - 2018, vBulletin Solutions, Inc.
Single Sign On provided by vBSSO