SEQanswers

Go Back   SEQanswers > Bioinformatics > Bioinformatics



Similar Threads
Thread Thread Starter Forum Replies Last Post
translated seq of tblastn hits carolW Bioinformatics 0 10-29-2014 07:16 AM
Can someone explain the output of BIC-seq? anibhax Bioinformatics 1 03-14-2014 12:46 PM
Software for mapping translated nucleotide sequences to a local reference database NYGAWI Bioinformatics 2 04-24-2012 09:05 AM

Reply
 
Thread Tools
Old 04-28-2017, 06:29 PM   #1
zaineb
Junior Member
 
Location: Orange, California

Join Date: Apr 2017
Posts: 1
Default My translated A.A seq longer than my original Nucleotide seq!! Could someone explain

Hello everyone!

I am in the process of identifying an uncharacterized protein, when I convert my nucleotide sequence to Amino Acid using blastx, I get a long Amino Acid sequence. I am not sure if I am doing something wrong or missing a step or there is a biological explanation for it that I don't know of.

Nucleotide sequence / Accession Number X79334 region 333-548

GTTATTGTGTTCGCCGTTTTGCTGACGGCTTCTTGTCTGATGGTCTCCTTTGCCAACAGCTTTACGCTGC
TATTGCTGGACCGCGCCTGTCTTGGGTTGGCGCTGGACGGATTCTGGGCGATGTCGGCGTCGCTGACCAT
GCGACTGGTTCCCGCGCGTACCGTGCCGAAAGCGCTGTCGGTGATTTTTGGCGCGGTCTCCATCGCGTTA
GTGATC

Amino Acid Sequence / Protein accession number ERH37120.1


MNENIAEKFRADGVARPNWSAVFAVAFCVACLITVEFLPVSLLTPMAQDLGISEGIAGQSVTVTAFVAMF
SSLFITQIIQATDRRYIVILFAVLLTASCLMVSFANSFTLLLLGRACLGLALGGFWAMSASLTMRLVPAR
TVPKALSVIFGAVSIALVIAAPLGSFFGCXGISWSGRXALRPSAVMGVLC

I am new to Bioinformatics, but I am fascinated by this developing field. I was researching my question and came across this amazing website. I hope someone can help.
zaineb is offline   Reply With Quote
Old 04-29-2017, 04:26 AM   #2
mastal
Senior Member
 
Location: uk

Join Date: Mar 2009
Posts: 667
Default

Did you check whether any part of the amino acid sequence corresponds to your nucleotide sequence?

Perhaps blastx translated the entire nucleotide sequence, 1-548, and not just the part annotated as a gene (333-548)? Would the length of the amino acid sequence be consistent with that?
mastal is offline   Reply With Quote
Old 04-29-2017, 11:40 AM   #3
r.rosati
Member
 
Location: Brazil

Join Date: Aug 2015
Posts: 90
Default

This is the full sequence of a matching protein that you're seeing.
Your sequence translates to:
VIVFAVLLTASCLMVSFANSFTLLLLDRACLGLALDGFWAMSASLTMRLVPARTVPKALSVIFGAVSIALVI
And it was aligned to the segment starting "VILFAVLLTASCLMVSFANS".
r.rosati is offline   Reply With Quote
Reply

Thread Tools

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off




All times are GMT -8. The time now is 01:03 PM.


Powered by vBulletin® Version 3.8.9
Copyright ©2000 - 2019, vBulletin Solutions, Inc.
Single Sign On provided by vBSSO