Hi all,
I'm experiencing an issue when running mpiBLAST 1.6.0 on our cluster. It runs fine however the results (from a TBLASTX run) do not have the complete name of the subject sequence in the output. Here's an example of part of the output:
The problem is that the subject title is being truncated (and having the full path included in the subject name isn't helping the issue). Does anyone know how to get around this?
I'm experiencing an issue when running mpiBLAST 1.6.0 on our cluster. It runs fine however the results (from a TBLASTX run) do not have the complete name of the subject sequence in the output. Here's an example of part of the output:
Code:
Sequences producing significant alignments: (bits) Value N 13893_/work1/xxmwebb/mpi_blast/databas 73 1e-14 1 >13893_/work1/xxmwebb/mpi_blast/databas Length = 9798 Score = 73.0 bits (162), Expect = 1e-14 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 / -3 Query: 105 LACQTLKSGYTESSRGSRVYFLVAFSLFLCTILTF 1 LACQTLKSGYTESSRGS VYFLVAFSLFLC+IL F Sbjct: 8944 LACQTLKSGYTESSRGSSVYFLVAFSLFLCSILAF 8840
Comment