SEQanswers

Go Back   SEQanswers > Bioinformatics > Bioinformatics



Similar Threads
Thread Thread Starter Forum Replies Last Post
Augustus: internal stop codons in transcripts mht Bioinformatics 2 09-21-2016 08:29 PM
What is the smallest number of amino acids required for life? Ganesh Ujwal General 1 01-04-2015 12:49 AM
What is the prehistory of amino acids in cells? Ganesh Ujwal General 0 01-03-2015 06:24 PM
gffread converts stop codons into CDS jg3197 Bioinformatics 0 06-05-2014 04:47 AM

Reply
 
Thread Tools
Old 02-01-2017, 08:22 AM   #1
mparida
Member
 
Location: Coralville IA

Join Date: Mar 2012
Posts: 15
Default Amino acids premature stop codons

Hi All
I have downloaded Daphnia pulex amino acid sequence from wFleabase.
I found this amino acid sequence:
>hxNCBI_GNO_20744
MAKETNLSGKTTAVSAGSHRPDAPNEDSPALEERKTWAKKAEFLLAVIGFAVDLGNVWRFPYICYKNGRGAFLIPYVVMMVFGVLPLFYM*LALGQFHRSGCLTPWKRI*PALKGVPFARHAICIIDFYMGMYCNTYSTYQKFGNAREKLIFLYLGGGHLQMDVWTDAASQEFFSLGPGFGTLLALSSYNKFHNNCFYDALLTSSINLATSLLAGFVIFAVLAYMAEIRNVSIDQLGLEGPPGLVFVVYPEAIATMAGSTFWSMIFFFLLITLGLDSTFGGLEAMITGLCDEYPVLLGRRRELFVGILLVFIYLCALPTTTYSGMYFVDLLNVFGPGII*

As you can see there are multiple stop codons in this amino acid sequence. I am trying to find interpro domains in this sequence. Interproscan will reject this sequence because of special characters in the middle of the aa sequence. Is there anyway to use this sequence to look for protein domains in them. For example, can I just take from beginning of the sequence until M* and use that as my input for protein domain search. Please let me know what you all think of this strategy.
mparida is offline   Reply With Quote
Reply

Tags
premature stop codons

Thread Tools

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off




All times are GMT -8. The time now is 02:21 PM.


Powered by vBulletin® Version 3.8.9
Copyright ©2000 - 2020, vBulletin Solutions, Inc.
Single Sign On provided by vBSSO