SEQanswers

Go Back   SEQanswers > Bioinformatics > Bioinformatics



Similar Threads
Thread Thread Starter Forum Replies Last Post
translated seq of tblastn hits carolW Bioinformatics 0 10-29-2014 07:16 AM
tblastn and blastx question Nepa10 Bioinformatics 3 09-24-2014 12:07 AM
Is it a bug in BWA? SD2010Bioinfo Bioinformatics 4 10-11-2012 05:27 PM
is it bug in cufflinks? jay2008 Bioinformatics 0 10-10-2012 02:16 PM
Inquiry of Parsing tblastn result to get nucleotide sequence from the db file sunfuhui Bioinformatics 2 09-12-2012 05:39 AM

Reply
 
Thread Tools
Old 05-18-2015, 08:57 AM   #1
Antony03
Member
 
Location: Canada, Quebec

Join Date: Apr 2012
Posts: 53
Default tblastn bug?

Hello,

I have a problem with tblastn. I tried to research this protein sequence:

>BN1129_RS00085
MNKVLVAGILGLMLTACGQKEEAAAPAATPAADVAATVEQAASEATSTVEKVASEATATVEKAVSKAEAAVSDAKAN

In the draft sequence with the accession number: CDBI00000000.1

The problem is that the result is truncated, which is a non-sense since the protein sequence come from this accession number! I tried locally with tfasty36 and there is no problem.

Is someone has an idea?

Thank you!
Antony03 is offline   Reply With Quote
Old 05-29-2015, 05:28 AM   #2
maubp
Peter (Biopython etc)
 
Location: Dundee, Scotland, UK

Join Date: Jul 2009
Posts: 1,543
Default

By default BLAST uses low complexity filters to remove/mask some of the sequence. Try turning off these filters?
maubp is offline   Reply With Quote
Reply

Thread Tools

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off




All times are GMT -8. The time now is 01:02 AM.


Powered by vBulletin® Version 3.8.9
Copyright ©2000 - 2020, vBulletin Solutions, Inc.
Single Sign On provided by vBSSO