Hi everyone,
I found this alignment in a format I don't recognize, neither my phylogenetic programs. Any idea? And any way to convert it to fasta, phylip, etc...
Thanks
I found this alignment in a format I don't recognize, neither my phylogenetic programs. Any idea? And any way to convert it to fasta, phylip, etc...
Thanks
Code:
193 Ce 13A10 Z46934 -------------------------MTQSLAHKNAWQC-- 13 194 Ce 13A8 Z48717 T10B9.4 ---------------------------------------- 0 195 Ce 13A7 Z48717 T10B9.10-------------------------MSFSI---------- 5 196 Ce 13A6 Z48717 T10B9.3 -------------------------MIFVL---------- 5 197 Ce 13A5 Z48717 T10B9.2 -------------------------MSLSI---------- 5 198 Ce 13A4 Z48717 T10B9.1 -------------------------MSLSL---------- 5 199 Ce 13A3 Z48717 T10B9.5 -------------------------MSLSI---------- 5 200 Ce 13A2 Z48717 T10B9.7 -------------------------MSLGF---------- 5 201 Ce 13A1 Z48717 T10B9.8 -------------------------MGYF----------- 4 202 Ce 25A1 Z66495 C36A4.1 -------------------------MAL------------ 0 203 Ce 25A2 Z66495 C36A4.2 -------------------------MAL------------ 0 204 Ce 25A3 Z66495 C36A4.3 -------------------------MAF------------ 0 205 Ce 25A4 Z66495 C36A4.6 -------------------------MAI------------ 0 206 Ce 14A1 Z50742 K09A11.2---------------------------------------- 0 207 Ce 14A2 Z50742 K09A11.3---------------------------------------- 0 208 Ce 14A3 Z50742 K09A11.4---------------------------------------- 0 209 Ce 14A4 Z50742 + R04D3 ---------------------------------------- 0 210 Ce 16A1 Z54269 ---------------------------------------- 0 Ce U55365 C12D5.7 ---------------------------------------- 0 Ce U50311 C25E10.2---------------------------------------- 0 211 Ce 22A1 U39648 T13C5.1 SSWIKCRDWMAFALSHHIIMGIYLLILRNFLPQVVPDFEW 0 212 Ce 23A1 U39472 B0304.3 -------------MPIAYFLPSQVNSGVCCLICRHWYLIG 0
Comment