Tweet
Hello,
I have a problem with tblastn. I tried to research this protein sequence:
>BN1129_RS00085
MNKVLVAGILGLMLTACGQKEEAAAPAATPAADVAATVEQAASEATSTVEKVASEATATVEKAVSKAEAAVSDAKAN
In the draft sequence with the accession number: CDBI00000000.1
The problem is that the result is truncated, which is a non-sense since the protein sequence come from this accession number! I tried locally with tfasty36 and there is no problem.
Is someone has an idea?
Thank you!
I have a problem with tblastn. I tried to research this protein sequence:
>BN1129_RS00085
MNKVLVAGILGLMLTACGQKEEAAAPAATPAADVAATVEQAASEATSTVEKVASEATATVEKAVSKAEAAVSDAKAN
In the draft sequence with the accession number: CDBI00000000.1
The problem is that the result is truncated, which is a non-sense since the protein sequence come from this accession number! I tried locally with tfasty36 and there is no problem.
Is someone has an idea?
Thank you!
Comment